Lineage for d6vmzb_ (6vmz B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3040856Species Influenza a virus (a/chicken/vietnam/30/2003(h5n1)) [TaxId:380830] [388683] (1 PDB entry)
  8. 3040857Domain d6vmzb_: 6vmz B: [388684]
    Other proteins in same PDB: d6vmza1, d6vmza2, d6vmzc1, d6vmzc2, d6vmze1, d6vmze2
    automated match to d4kdmb_
    complexed with nag, r3p

Details for d6vmzb_

PDB Entry: 6vmz (more details), 2.2 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin with cbs1117
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6vmzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vmzb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza a virus (a/chicken/vietnam/30/2003(h5n1)) [TaxId: 380830]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeis

SCOPe Domain Coordinates for d6vmzb_:

Click to download the PDB-style file with coordinates for d6vmzb_.
(The format of our PDB-style files is described here.)

Timeline for d6vmzb_: