Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Faecalibacterium prausnitzii [TaxId:853] [376260] (1 PDB entry) |
Domain d6u7ia3: 6u7i A:286-596 [376334] Other proteins in same PDB: d6u7ia1, d6u7ia2, d6u7ib1, d6u7ib2, d6u7ic1, d6u7ic2, d6u7id1, d6u7id2 automated match to d3hn3a3 |
PDB Entry: 6u7i (more details), 2.7 Å
SCOPe Domain Sequences for d6u7ia3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u7ia3 c.1.8.0 (A:286-596) automated matches {Faecalibacterium prausnitzii [TaxId: 853]} ievrgtqvllngkplyfkgfckhedftahgrgfdpvlnvkdvnlihwananavrtshypy aeefydlcdregilvmdetpavgigggaavnpykeyplaehhrqvlaemihrdknhpcvv lwslgnepnlehfpqdaydywhplyelahqldpqdrpvtlvccqndytkdittrtmdivc inryygwynlsgdmdaacyglnqeldfwaeqhkpvmmseygadtvaglhtagaemfseef qvefyrrldaefdkrpwfvgefvwnfadydtvqgpmrvdgnkkglftrdrrpklgmhflr qrwaeiptfgf
Timeline for d6u7ia3: