Lineage for d6apea2 (6ape A:126-288)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847022Species Helicobacter pylori [TaxId:563041] [256091] (2 PDB entries)
  8. 2847023Domain d6apea2: 6ape A:126-288 [338878]
    Other proteins in same PDB: d6apea1
    automated match to d4cjxb2
    complexed with gol, na

Details for d6apea2

PDB Entry: 6ape (more details), 1.45 Å

PDB Description: crystal structure of bifunctional protein fold from helicobacter pylori
PDB Compounds: (A:) Bifunctional protein folD

SCOPe Domain Sequences for d6apea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6apea2 c.2.1.0 (A:126-288) automated matches {Helicobacter pylori [TaxId: 563041]}
fhplnigklctqkesflpatpmgvmrllkhyhieikgkdvaiigasniigkplsmlmlna
gasvsvchiltkdisfytqnadivcvgvgkpdlikasmlkkgavvvdiginhlndgrivg
dvdftnaqkvagfitpvpkgvgpmtivsllentliafekqqrk

SCOPe Domain Coordinates for d6apea2:

Click to download the PDB-style file with coordinates for d6apea2.
(The format of our PDB-style files is described here.)

Timeline for d6apea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6apea1