Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (160 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [320074] (12 PDB entries) |
Domain d5xt5b_: 5xt5 B: [343310] Other proteins in same PDB: d5xt5a2, d5xt5c_, d5xt5d_ automated match to d4lw2a_ complexed with plp, zn |
PDB Entry: 5xt5 (more details), 2.34 Å
SCOPe Domain Sequences for d5xt5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xt5b_ c.67.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]} mnitdireqfpilhqqvnghdlvyldsaatsqkpravietldkyynqynsnvhrgvhtlg tratdgyegarekvrkfinaksmaeiiftkgtttslnmvalsyaranlkpgdevvityme hhaniipwqqavkatgatlkyiplqedgtisledvretvtsntkivavshvsnvlgtvnp ikemakiahdngavivvdgaqstphmkidvqdldcdffalsshkmcgptgvgvlygkkal lenmepaefggemidfvglyestwkelpwkfeagtpiiagaiglgaaidfleeigldeis rhehklaayalerfrqldgvtvygpeeraglvtfnlddvhphdvatvldaegiavraghh caqplmkwldvtatarasfylynteeeidklvealqktkeyftnv
Timeline for d5xt5b_:
View in 3D Domains from other chains: (mouse over for more information) d5xt5a1, d5xt5a2, d5xt5c_, d5xt5d_ |