Lineage for d5xnlc_ (5xnl c:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028864Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 3028865Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 3028866Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 3028885Protein automated matches [191285] (5 species)
    not a true protein
  7. 3028889Species Pea (Pisum sativum) [TaxId:3888] [339421] (1 PDB entry)
  8. 3028891Domain d5xnlc_: 5xnl c: [339422]
    Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnla_, d5xnld_, d5xnle_, d5xnlf_, d5xnlg_, d5xnlh_, d5xnlk_, d5xnlm_, d5xnln_, d5xnlo_, d5xnlp_, d5xnls_, d5xnly_, d5xnlz_
    automated match to d4il6c_
    complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnlc_

PDB Entry: 5xnl (more details), 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum
PDB Compounds: (c:) Photosystem II CP43 reaction center protein

SCOPe Domain Sequences for d5xnlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xnlc_ f.55.1.1 (c:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
tgrdqettgfawwagnarlinlsgkllgahvahaglivfwagamnlfevahfvpekpmye
qglillphlatlgwgvgpggevidtfpyfvsgvlhlissavlgfggiyhallgpetlees
fpffgyvwkdrnkmttilgihlillgigsfllvfkafyfggiydtwapgggdvrkitnft
lspsilfgyllkspfggegwivsvddlediigghvwlgsicilggiwhiltkpfawarra
lvwsgeaylsyslgalavfgfiaccfvwfnntaypsefygptgpeasqaqaftflvrdqr
lganvgsaqgptglgkylmrsptgevifggetmrfwdlrapwleplrgpngldlsrlkkd
iqpwqerrsaeymthaplgslnsvggvateinavnyvsprswlatshfvlgfflfvghlw
hagraraaaagfekgidrdfepvlsmtpln

SCOPe Domain Coordinates for d5xnlc_:

Click to download the PDB-style file with coordinates for d5xnlc_.
(The format of our PDB-style files is described here.)

Timeline for d5xnlc_: