Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily) 6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops |
Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) automatically mapped to Pfam PF00421 |
Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins) Pfam PF00421 |
Protein automated matches [191285] (5 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [339421] (1 PDB entry) |
Domain d5xnlc_: 5xnl c: [339422] Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnla_, d5xnld_, d5xnle_, d5xnlf_, d5xnlg_, d5xnlh_, d5xnlk_, d5xnlm_, d5xnln_, d5xnlo_, d5xnlp_, d5xnls_, d5xnly_, d5xnlz_ automated match to d4il6c_ complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat |
PDB Entry: 5xnl (more details), 2.7 Å
SCOPe Domain Sequences for d5xnlc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xnlc_ f.55.1.1 (c:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} tgrdqettgfawwagnarlinlsgkllgahvahaglivfwagamnlfevahfvpekpmye qglillphlatlgwgvgpggevidtfpyfvsgvlhlissavlgfggiyhallgpetlees fpffgyvwkdrnkmttilgihlillgigsfllvfkafyfggiydtwapgggdvrkitnft lspsilfgyllkspfggegwivsvddlediigghvwlgsicilggiwhiltkpfawarra lvwsgeaylsyslgalavfgfiaccfvwfnntaypsefygptgpeasqaqaftflvrdqr lganvgsaqgptglgkylmrsptgevifggetmrfwdlrapwleplrgpngldlsrlkkd iqpwqerrsaeymthaplgslnsvggvateinavnyvsprswlatshfvlgfflfvghlw hagraraaaagfekgidrdfepvlsmtpln
Timeline for d5xnlc_: