Lineage for d5w83b_ (5w83 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489936Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2490288Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) (S)
  5. 2490289Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins)
    Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)
  6. 2490314Protein Proteasome regulatory subunit Rpn11 [346088] (1 species)
  7. 2490315Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346338] (5 PDB entries)
  8. 2490316Domain d5w83b_: 5w83 B: [344421]
    Other proteins in same PDB: d5w83a_
    complexed with zn

Details for d5w83b_

PDB Entry: 5w83 (more details), 1.55 Å

PDB Description: rpn8/rpn11 dimer complex
PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase RPN11

SCOPe Domain Sequences for d5w83b_:

Sequence, based on SEQRES records: (download)

>d5w83b_ c.97.3.1 (B:) Proteasome regulatory subunit Rpn11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ketvyissiallkmlkhgragvpmevmglmlgefvddytvnvvdvfampqsgtgvsveav
ddvfqakmmdmlkqtgrdqmvvgwyhshpgfgcwlssvdvntqksfeqlnsravavvvdp
iqsvkgkvvidafrlidtgalinnleprqttsntgllnkaniqalihglnrhyyslnidy
hktaketkmlmnlhkeqwq

Sequence, based on observed residues (ATOM records): (download)

>d5w83b_ c.97.3.1 (B:) Proteasome regulatory subunit Rpn11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ketvyissiallkmlkhgragvpmevmglmlgefvddytvnvvdvfampqsavddvfqak
mmdmlkqtgrdqmvvgwyhshpgfgcwlssvdvntqksfeqlnsravavvvdpiqsvkgk
vvidafrlidhyyslnidyhktaketkmlmnlhkeqwq

SCOPe Domain Coordinates for d5w83b_:

Click to download the PDB-style file with coordinates for d5w83b_.
(The format of our PDB-style files is described here.)

Timeline for d5w83b_:

  • d5w83b_ is new in SCOPe 2.07-stable