Lineage for d5vp0b_ (5vp0 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737183Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2737184Protein automated matches [190983] (12 species)
    not a true protein
  7. 2737203Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)
  8. 2737431Domain d5vp0b_: 5vp0 B: [338344]
    automated match to d4d09a_
    complexed with 9gj, mg, zn

Details for d5vp0b_

PDB Entry: 5vp0 (more details), 2.2 Å

PDB Description: discovery of clinical candidate n-{(1s)-1-[3-fluoro-4- (trifluoromethoxy)phenyl]-2-methoxyethyl}-7-methoxy-2-oxo-2,3- dihydropyrido[2,3-b]pyrazine-4(1h)-carboxamide (tak-915), a highly potent, selective, and brain-penetrating phosphodiesterase 2a inhibitor for the treatment of cognitive disorders
PDB Compounds: (B:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5vp0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vp0b_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcp
tlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchd
ldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrm
ldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwk
ttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdl
fpkaaelyervasnrehwtkvshkftirglpsnnsldfl

SCOPe Domain Coordinates for d5vp0b_:

Click to download the PDB-style file with coordinates for d5vp0b_.
(The format of our PDB-style files is described here.)

Timeline for d5vp0b_: