Lineage for d5veva3 (5vev A:326-423)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817540Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2817665Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2817666Protein automated matches [254496] (16 species)
    not a true protein
  7. 2817719Species Neisseria gonorrhoeae [TaxId:521006] [333087] (1 PDB entry)
  8. 2817720Domain d5veva3: 5vev A:326-423 [333088]
    Other proteins in same PDB: d5veva1, d5veva2, d5veva4, d5vevb1, d5vevb2, d5vevb4
    automated match to d1gsoa1
    complexed with act, edo, na, so4

Details for d5veva3

PDB Entry: 5vev (more details), 1.9 Å

PDB Description: crystal structure of phosphoribosylamine-glycine ligase from neisseria gonorrhoeae
PDB Compounds: (A:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d5veva3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5veva3 b.84.2.0 (A:326-423) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
pqtavgvvlaaqnypetpkkgdvisglddvnrigkvfhagttvnekgdvltnggrilcvv
glgddvaqakakaygalekisfdgmqyrkdiadkainr

SCOPe Domain Coordinates for d5veva3:

Click to download the PDB-style file with coordinates for d5veva3.
(The format of our PDB-style files is described here.)

Timeline for d5veva3: