SCOPe 2.07: Domain d5ujta2: 5ujt A:82-181

Lineage for d5ujta2 (5ujt A:82-181)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
Domain d5ujta2: 5ujt A:82-181 [343340]
Other proteins in same PDB: d5ujta1, d5ujtb1, d5ujtd1, d5ujte1, d5ujtg1, d5ujth1
automated match to d4z7va2
complexed with nag

Details for d5ujta2

PDB Entry: 5ujt (more details), 1.94 Å

PDB Description: crystal structure of human hla-dq8 in complex with insulin mimotope binding in register 3

PDB Compounds: (A:) MHC class II antigen

SCOPe Domain Sequences for d5ujta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ujta2 b.1.1.2 (A:82-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsnghsvtegvsetsflsks
dhsffkisyltflpsddeiydckvehwgldepllkhwepe

SCOPe Domain Coordinates for d5ujta2:

Click to download the PDB-style file with coordinates for d5ujta2.
(The format of our PDB-style files is described here.)

Timeline for d5ujta2: