Lineage for d5ufra_ (5ufr A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
multihelical; 3 layers or orthogonally packed helicesSuperfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) 
Family a.123.1.0: automated matches [191623] (1 protein)
not a true familyProtein automated matches [191142] (5 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries) 
Domain d5ufra_: 5ufr A: [332801]
automated match to d3l0la_
complexed with 88j
Details for d5ufra_
PDB Entry: 5ufr (more details), 2.07 Å
PDB Description: structure of rorgt bound to
PDB Compounds: (A:) Nuclear receptor ROR-gammaSCOPe Domain Sequences for d5ufra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ufra_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifq
SCOPe Domain Coordinates for d5ufra_:
Click to download the PDB-style file with coordinates for d5ufra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ufra_:
- d5ufra_ first appeared in SCOPe 2.06
- d5ufra_ appears in SCOPe 2.07
View in 3D
