Lineage for d5u4lb_ (5u4l B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.0: automated matches [191470] (1 protein)
not a true familyProtein automated matches [190740] (31 species)
not a true protein
Species Vicugna pacos [TaxId:30538] [276396] (23 PDB entries) 
Domain d5u4lb_: 5u4l B: [342860]
Other proteins in same PDB: d5u4la_
automated match to d1igmh_
complexed with cl, edo, po4
Details for d5u4lb_
PDB Entry: 5u4l (more details), 2.5 Å
PDB Description: rta-v1c7_g29r-high-salt
PDB Compounds: (B:) V1C7 VHH antibody G29R variantSCOPe Domain Sequences for d5u4lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u4lb_ b.1.1.0 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
snaqvqlvesggglvqpggslrlscvasefsrftldyyaigwfrqapgkereglssisss
sdgftsysdsvkgrftisrdnakntvylqmnslkpedtavyycaarlggwasfspqeydy
wgqgtqvtvss
SCOPe Domain Coordinates for d5u4lb_:
Click to download the PDB-style file with coordinates for d5u4lb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5u4lb_:
- d5u4lb_ first appeared in SCOPe 2.06
- d5u4lb_ appears in SCOPe 2.07
View in 3D
