Lineage for d5tqma_ (5tqm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848528Species Sorghum (Sorghum bicolor) [TaxId:4558] [333537] (1 PDB entry)
  8. 2848529Domain d5tqma_: 5tqm A: [333538]
    automated match to d4r1sa_
    complexed with dtt, gol, nap

Details for d5tqma_

PDB Entry: 5tqm (more details), 2.9 Å

PDB Description: cinnamoyl-coa reductase 1 from sorghum bicolor in complex with nadp+
PDB Compounds: (A:) Cinnamoyl-CoA Reductase

SCOPe Domain Sequences for d5tqma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tqma_ c.2.1.0 (A:) automated matches {Sorghum (Sorghum bicolor) [TaxId: 4558]}
gqtvcvtgaagyiaswlvkmllekgytvkgtvrnpddpknahlkaldgaaerlilckadl
ldydaicravqgcqgvfhtaspvtddpeqmvepavrgteyvinaaaeagtvrrvvftssi
gavtmdpsrgpdvvvdescwsdlefckktrnwycygkavaeqaawdaarqrgvdlvvvnp
vlvvgpllqptvnasiahvlkyldgsartfanavqayvdvrdvadahlrvfespaasgry
lcaervlhredvvrilaklfpeypvptrcsdevnprkqpykfsnqklrdlglefrpvsqs
lydtvknlqekghlp

SCOPe Domain Coordinates for d5tqma_:

Click to download the PDB-style file with coordinates for d5tqma_.
(The format of our PDB-style files is described here.)

Timeline for d5tqma_: