Lineage for d5t65a_ (5t65 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
Superfamily d.110.6: Sensory domain-like [103190] (5 families) 
alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domainFamily d.110.6.4: Histidine kinase family 1 (HK1) sensor domains [345974] (6 proteins)
Pfam PF02743, contains double domain arrangement like LuxQ
Protein Methyl-accepting chemotaxis protein PctA [346102] (2 species) 
Species Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964] [346376] (1 PDB entry) 
Domain d5t65a_: 5t65 A: [345843]
complexed with act, ile, so4
Details for d5t65a_
PDB Entry: 5t65 (more details), 2.2 Å
PDB Description: ligand binding domain of pseudomonas aeruginosa pao1 amino acid chemoreceptor pcta in complex with l-ile
PDB Compounds: (A:) Methyl-accepting chemotaxis protein PctASCOPe Domain Sequences for d5t65a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t65a_ d.110.6.4 (A:) Methyl-accepting chemotaxis protein PctA {Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId: 208964]}
ndylqrnairedlesylremgdvtssniqnwlggrlllveqtaqtlardhspetvsalle
qpaltstfsftylgqqdgvftmrpdspmpagydprsrpwykdavaaggltltepyvdaat
qeliitaatpvkaagntlgvvggdlslktlvqiinsldfsgmgyaflvsgdgkilvhpdk
eqvmktlsevypqntpkiatgfseaelhghtrilaftpikglpsvtwylalsidkdkaya
SCOPe Domain Coordinates for d5t65a_:
Click to download the PDB-style file with coordinates for d5t65a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5t65a_:
- d5t65a_ first appeared in SCOPe 2.07
View in 3D
