Lineage for d5mtjb_ (5mtj B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families) 
Family b.1.2.0: automated matches [191562] (1 protein)
not a true familyProtein automated matches [190976] (5 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries) 
Domain d5mtjb_: 5mtj B: [332658]
Other proteins in same PDB: d5mtja_
automated match to d3uyod_
complexed with cxs, so4
Details for d5mtjb_
PDB Entry: 5mtj (more details), 1.95 Å
PDB Description: yes1-sh2 in complex with monobody mb(yes_1)
PDB Compounds: (B:) Monobody Mb(Yes_1)SCOPe Domain Sequences for d5mtjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mtjb_ b.1.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vssvptklevvaatptslliswdapavtvdyyfitygetggnspvqeftvpgskstatis
glkpgvdytitvyawyyyddeyymnesspisinyrt
SCOPe Domain Coordinates for d5mtjb_:
Click to download the PDB-style file with coordinates for d5mtjb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5mtjb_:
- d5mtjb_ first appeared in SCOPe 2.06
- d5mtjb_ appears in SCOPe 2.07
View in 3D
