Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries) |
Domain d5m7qa1: 5m7q A:1-129 [326080] Other proteins in same PDB: d5m7qa2, d5m7qb2 automated match to d1mqkh_ complexed with cl, mg, so4 |
PDB Entry: 5m7q (more details), 1.8 Å
SCOPe Domain Sequences for d5m7qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m7qa1 b.1.1.1 (A:1-129) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} qvqlqesgggsvqaggslrlscavsentgrmgwfrqapgkerekvaiitrlggytsyagp vkgrftisqdnakntvyllmnslkpedtaiyycaadsrpiysgtwrywgqgtqvtvssaa aypydvpdy
Timeline for d5m7qa1: