Lineage for d5m7qa1 (5m7q A:1-129)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355069Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)
  8. 2355096Domain d5m7qa1: 5m7q A:1-129 [326080]
    Other proteins in same PDB: d5m7qa2, d5m7qb2
    automated match to d1mqkh_
    complexed with cl, mg, so4

Details for d5m7qa1

PDB Entry: 5m7q (more details), 1.8 Å

PDB Description: engineering the thermostability of nanobodies - nbd2
PDB Compounds: (A:) Nanobody NbD2

SCOPe Domain Sequences for d5m7qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m7qa1 b.1.1.1 (A:1-129) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlqesgggsvqaggslrlscavsentgrmgwfrqapgkerekvaiitrlggytsyagp
vkgrftisqdnakntvyllmnslkpedtaiyycaadsrpiysgtwrywgqgtqvtvssaa
aypydvpdy

SCOPe Domain Coordinates for d5m7qa1:

Click to download the PDB-style file with coordinates for d5m7qa1.
(The format of our PDB-style files is described here.)

Timeline for d5m7qa1:

2355096
d5m7qa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5m7qa2