Lineage for d5lsca_ (5lsc A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) 
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) Protein automated matches [190079] (12 species)
not a true proteinSpecies Pseudomonas aeruginosa [TaxId:287] [189349] (76 PDB entries) 
Domain d5lsca_: 5lsc A: [325981]
automated match to d5a87b_
complexed with 752, cl, zn
Details for d5lsca_
PDB Entry: 5lsc (more details), 1.5 Å
PDB Description: the structure of the metallo-beta-lactamase vim-2 in complex with a triazolylthioacetamide inhibitor
PDB Compounds: (A:) Metallo-beta-lactamase VIM-2-like proteinSCOPe Domain Sequences for d5lsca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lsca_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
sgeyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawga
kntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegne
ipthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsag
nvadadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrsv
SCOPe Domain Coordinates for d5lsca_:
Click to download the PDB-style file with coordinates for d5lsca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5lsca_:
- d5lsca_ first appeared in SCOPe 2.06
- d5lsca_ appears in SCOPe 2.07
View in 3D
