Lineage for d5kjxa_ (5kjx A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816902Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2816903Protein automated matches [226927] (20 species)
    not a true protein
  7. 2816931Species Human (Homo sapiens) [TaxId:9606] [256346] (16 PDB entries)
  8. 2816945Domain d5kjxa_: 5kjx A: [335997]
    automated match to d4ku7a_
    complexed with cmp

Details for d5kjxa_

PDB Entry: 5kjx (more details), 1.9 Å

PDB Description: co-crystal structure of pka ri alpha cnb-b domain with camp
PDB Compounds: (A:) cAMP-dependent protein kinase type I-alpha regulatory subunit

SCOPe Domain Sequences for d5kjxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kjxa_ b.82.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkrkmyeeflskvsilesldkwerltvadalepvqfedgqkivvqgepgdeffiilegsa
avlqrrseneefvevgrlgpsdyfgeiallmnrpraatvvargplkcvkldrprfervlg
pcsdilkrniqqynsfvslsv

SCOPe Domain Coordinates for d5kjxa_:

Click to download the PDB-style file with coordinates for d5kjxa_.
(The format of our PDB-style files is described here.)

Timeline for d5kjxa_: