Lineage for d5k2la_ (5k2l A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928808Fold d.7: LysM domain [54105] (1 superfamily)
    beta-alpha(2)-beta; antiparallel strands
  4. 2928809Superfamily d.7.1: LysM domain [54106] (2 families) (S)
    automatically mapped to Pfam PF01476
  5. 2928818Family d.7.1.0: automated matches [234000] (1 protein)
    not a true family
  6. 2928819Protein automated matches [234001] (7 species)
    not a true protein
  7. 2928863Species Volvox carteri [TaxId:3068] [330095] (3 PDB entries)
  8. 2928864Domain d5k2la_: 5k2l A: [330096]
    automated match to d4uz3c_
    complexed with edo

Details for d5k2la_

PDB Entry: 5k2l (more details), 1.2 Å

PDB Description: crystal structure of lysm domain from volvox carteri chitinase
PDB Compounds: (A:) Chitinase, lysozyme

SCOPe Domain Sequences for d5k2la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k2la_ d.7.1.0 (A:) automated matches {Volvox carteri [TaxId: 3068]}
mgctytiqpgdtfwaiaqrrgttvdviqslnpgvnparlqvgqvinvpc

SCOPe Domain Coordinates for d5k2la_:

Click to download the PDB-style file with coordinates for d5k2la_.
(The format of our PDB-style files is described here.)

Timeline for d5k2la_: