Lineage for d5jq1a_ (5jq1 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily)
unusual foldSuperfamily d.169.1: C-type lectin-like [56436] (9 families) 
Family d.169.1.0: automated matches [191331] (1 protein)
not a true familyProtein automated matches [190159] (21 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries) 
Domain d5jq1a_: 5jq1 A: [335418]
automated match to d4gj0a_
complexed with ca, cl, zpf
Details for d5jq1a_
PDB Entry: 5jq1 (more details), 1.83 Å
PDB Description: efficient targeting of the asialoglycoprotein receptor by polyvalent display of a compact galactosamine mimic
PDB Compounds: (A:) asialoglycoprotein receptor 1SCOPe Domain Sequences for d5jq1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jq1a_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tccpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhigpvntw
mglhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnddvcqr
pyrwvcetel
SCOPe Domain Coordinates for d5jq1a_:
Click to download the PDB-style file with coordinates for d5jq1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5jq1a_:
- d5jq1a_ first appeared in SCOPe 2.06
- d5jq1a_ appears in SCOPe 2.07
View in 3D
