Lineage for d5ivpb_ (5ivp B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497093Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2497110Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2497111Protein automated matches [193326] (11 species)
    not a true protein
  7. 2497189Species Vibrio cholerae [TaxId:243277] [311867] (10 PDB entries)
  8. 2497198Domain d5ivpb_: 5ivp B: [331649]
    automated match to d4y2zb_
    complexed with flc

Details for d5ivpb_

PDB Entry: 5ivp (more details), 2.01 Å

PDB Description: crystal structure of the peptidyl-trna hydrolase from vibrio cholerae in the c121 space group at ph 6.5
PDB Compounds: (B:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d5ivpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ivpb_ c.56.3.0 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
sqpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllinsqel
rvlipttfmnlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghnglkd
tisklgnnkefyrlrlgighpghkdkvagyvlgkapakeqexldaavdesvrcleilmkd
gltkaqnrlhtfkae

SCOPe Domain Coordinates for d5ivpb_:

Click to download the PDB-style file with coordinates for d5ivpb_.
(The format of our PDB-style files is described here.)

Timeline for d5ivpb_: