Lineage for d5i4va_ (5i4v A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729657Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)
  8. 2729892Domain d5i4va_: 5i4v A: [319057]
    Other proteins in same PDB: d5i4vb2
    automated match to d1p8da_
    complexed with 67s

Details for d5i4va_

PDB Entry: 5i4v (more details), 2.61 Å

PDB Description: discovery of novel, orally efficacious liver x receptor (lxr) beta agonists
PDB Compounds: (A:) Oxysterols receptor LXR-beta,Nuclear receptor coactivator 2

SCOPe Domain Sequences for d5i4va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i4va_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpasgsasqqrfahftelaii
svqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftysk
ddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqq
pyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiw
dvhegsgsgshkilhrllqd

SCOPe Domain Coordinates for d5i4va_:

Click to download the PDB-style file with coordinates for d5i4va_.
(The format of our PDB-style files is described here.)

Timeline for d5i4va_: