Class a: All alpha proteins [46456] (290 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
Protein automated matches [196409] (46 species) not a true protein |
Species Streptomyces citricolor [TaxId:212427] [315296] (1 PDB entry) |
Domain d5i1ua_: 5i1u A: [315324] automated match to d5dz2a_ complexed with so4 |
PDB Entry: 5i1u (more details), 1.5 Å
SCOPe Domain Sequences for d5i1ua_:
Sequence, based on SEQRES records: (download)
>d5i1ua_ a.128.1.0 (A:) automated matches {Streptomyces citricolor [TaxId: 212427]} msddtslelpfthrrnphqteaadrhlewlqrhrelaavvsgstytgwditelaslvype ssaedlalaadlmgfyflfddqfdsplgrrpeqvalicerlsaiahgtltavtspseraf adlwrritlgmtdrwraraacnweyyfachpaeaagrtigqppdregyltlrrgtaames ifdmierlghfevpqhvmhhplfrqlrqlaadipsftndvrsfaqesergdvanlvmivr rdrccstaeacavvwdeaqrmadrfcdlrdqlpdacrsmsldpaqrlaaeryadgmalwl agylhwesht
>d5i1ua_ a.128.1.0 (A:) automated matches {Streptomyces citricolor [TaxId: 212427]} msddtslelpfthrrnphqteaadrhlewlqrhrelaavvsgstytgwditelaslvype ssaedlalaadlmgfyflfddqfdsplgrrpeqvalicerlsaiahgtltavtspseraf adlwrritlgmtdrwraraacnweyyfachpaeaagrppdregyltlrrgtaamesifdm ierlghfevpqhvmhhplfrqlrqlaadipsftndvrsfaqeanlvmivrrdrccstaea cavvwdeaqrmadrfcdlrdqlpdacrsmsldpaqrlaaeryadgmalwlagylhwesht
Timeline for d5i1ua_: