Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) |
Family c.87.1.0: automated matches [191559] (1 protein) not a true family |
Protein automated matches [190965] (40 species) not a true protein |
Species Candida albicans [TaxId:237561] [333712] (4 PDB entries) |
Domain d5hvlb_: 5hvl B: [333889] automated match to d2wtxb_ complexed with so4, udp, vdm |
PDB Entry: 5hvl (more details), 1.8 Å
SCOPe Domain Sequences for d5hvlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hvlb_ c.87.1.0 (B:) automated matches {Candida albicans [TaxId: 237561]} gkvlvvsnripvtikrldngsydysmssgglvtalqglkkttefqwygwpgleipedeqt kvndelkskfnctaiflsdtiadlhyngfsnsilwplfhyhpgemnfdenawaayieank kfaleivkqvndddmiwvhdyhlmllpemlrqeignkkknikigfflhtpfpsseiyril pvrkeilegvlscdligfhtydyarhfissvsrivpnvstlpngikyqgrsisigafpig idvdnfidglkkdsvverikqlkskfkdvkvivgvdrldyikgvpqklhafevflnenpe wigkvvlvqvavpsrgdveeyqslrstvselvgringefgtvefvpihylhksipfdeli slynisdvclvsstrdgmnlvsyeyiacqqdrkgvlilsefagaaqslngalivnpwnte dlseaikesltlpeekrefnfkklftyiskytsgfwgesfvkelyk
Timeline for d5hvlb_: