Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (22 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries) |
Domain d5hpte_: 5hpt E: [314770] Other proteins in same PDB: d5hptc_, d5hptf_ automated match to d3b1lx_ |
PDB Entry: 5hpt (more details), 2.84 Å
SCOPe Domain Sequences for d5hpte_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hpte_ d.15.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mqilvktftwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn ikmgsslylvlrlpgq
Timeline for d5hpte_:
View in 3D Domains from other chains: (mouse over for more information) d5hptb_, d5hptc_, d5hptf_, d5hpth_ |