Lineage for d5hmnc_ (5hmn C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187564Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2187565Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2188102Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2188103Protein automated matches [190038] (42 species)
    not a true protein
  7. 2271491Species Uncultured bacterium [TaxId:77133] [314792] (3 PDB entries)
  8. 2271498Domain d5hmnc_: 5hmn C: [314799]
    Other proteins in same PDB: d5hmnb2, d5hmnd2
    automated match to d1bo4a_
    complexed with coa, pg4

Details for d5hmnc_

PDB Entry: 5hmn (more details), 2.02 Å

PDB Description: crystal structure of an aminoglycoside acetyltransferase hmb0005 from an uncultured soil metagenomic sample, unknown active site density modeled as polyethylene glycol
PDB Compounds: (C:) aac3-I

SCOPe Domain Sequences for d5hmnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hmnc_ d.108.1.0 (C:) automated matches {Uncultured bacterium [TaxId: 77133]}
msldvhqlspnevalmetllatfgeafndmetytgnrprgaysrrllesdyfialaaley
geivgglaayelkkfeqerseiyiydlavakahrrrgiatalieklkelgaargayvifv
qadtaiedepaialysklgvreevlhfdipvs

SCOPe Domain Coordinates for d5hmnc_:

Click to download the PDB-style file with coordinates for d5hmnc_.
(The format of our PDB-style files is described here.)

Timeline for d5hmnc_:

  • d5hmnc_ appears in periodic updates to SCOPe 2.06 starting on 2016-04-15