Lineage for d5fl4a_ (5fl4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811457Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2811458Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2812758Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2812759Protein automated matches [191011] (16 species)
    not a true protein
  7. 2812843Species Human (Homo sapiens) [TaxId:9606] [188766] (28 PDB entries)
  8. 2812860Domain d5fl4a_: 5fl4 A: [279321]
    automated match to d3iaia_
    complexed with 9fk, acy, gol, zn

Details for d5fl4a_

PDB Entry: 5fl4 (more details), 1.82 Å

PDB Description: three dimensional structure of human carbonic anhydrase ix in complex with 5-(1-naphthalen-1-yl-1,2,3-triazol-4-yl)thiophene-2-sulfonamide
PDB Compounds: (A:) Carbonic anhydrase 9

SCOPe Domain Sequences for d5fl4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fl4a_ b.74.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnngh
svqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafa
rvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsd
fsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqp
lngrvieasfp

SCOPe Domain Coordinates for d5fl4a_:

Click to download the PDB-style file with coordinates for d5fl4a_.
(The format of our PDB-style files is described here.)

Timeline for d5fl4a_: