Lineage for d5effa_ (5eff A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein automated matches [190057] (28 species)
not a true protein
Species Bacillus sp. [TaxId:65673] [187690] (11 PDB entries) 
Domain d5effa_: 5eff A: [324383]
automated match to d4qdma_
complexed with cl, mg, na; mutant
Details for d5effa_
PDB Entry: 5eff (more details), 2.23 Å
PDB Description: crystal structure of an aromatic mutant (f4a) of an alkali thermostable gh10 xylanase from bacillus sp. ng-27
PDB Compounds: (A:) Beta-xylanaseSCOPe Domain Sequences for d5effa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5effa_ c.1.8.3 (A:) automated matches {Bacillus sp. [TaxId: 65673]}
vqpaawqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpee
gvftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqanke
lllerlethiktvverykddvtawdvvnevvddgtpnerglresvwyqitgdeyirvafe
tarkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptide
irtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelyee
ldadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid
SCOPe Domain Coordinates for d5effa_:
Click to download the PDB-style file with coordinates for d5effa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5effa_:
- d5effa_ first appeared in SCOPe 2.06
- d5effa_ appears in SCOPe 2.07
View in 3D
