Lineage for d5e25a_ (5e25 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018494Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 3018495Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 3018614Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 3018615Protein automated matches [190815] (21 species)
    not a true protein
  7. 3018659Species Geoglobus acetivorans [TaxId:565033] [322475] (2 PDB entries)
  8. 3018663Domain d5e25a_: 5e25 A: [323599]
    automated match to d2eiya_
    complexed with akg, plp

Details for d5e25a_

PDB Entry: 5e25 (more details), 2.2 Å

PDB Description: crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate
PDB Compounds: (A:) branched-chain aminotransferase

SCOPe Domain Sequences for d5e25a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e25a_ e.17.1.0 (A:) automated matches {Geoglobus acetivorans [TaxId: 565033]}
sellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarvi
dlkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpwg
klygdlyekglkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhng
yisegsgdnifivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysad
eifvtgtaaeiapvtyidgrtvgngkpgkvtkmlmekfrertenegveiy

SCOPe Domain Coordinates for d5e25a_:

Click to download the PDB-style file with coordinates for d5e25a_.
(The format of our PDB-style files is described here.)

Timeline for d5e25a_: