Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily) 2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8 |
Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) |
Family e.17.1.0: automated matches [191499] (1 protein) not a true family |
Protein automated matches [190815] (21 species) not a true protein |
Species Geoglobus acetivorans [TaxId:565033] [322475] (2 PDB entries) |
Domain d5e25a_: 5e25 A: [323599] automated match to d2eiya_ complexed with akg, plp |
PDB Entry: 5e25 (more details), 2.2 Å
SCOPe Domain Sequences for d5e25a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e25a_ e.17.1.0 (A:) automated matches {Geoglobus acetivorans [TaxId: 565033]} sellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarvi dlkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpwg klygdlyekglkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhng yisegsgdnifivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysad eifvtgtaaeiapvtyidgrtvgngkpgkvtkmlmekfrertenegveiy
Timeline for d5e25a_: