Lineage for d5cgfk_ (5cgf K:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2201421Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2201437Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2202327Domain d5cgfk_: 5cgf K: [279563]
    Other proteins in same PDB: d5cgfb_, d5cgfc_, d5cgfd_, d5cgfg_, d5cgfh_, d5cgfm_, d5cgfp_, d5cgfq_, d5cgfr_, d5cgfu_, d5cgfv_
    automated match to d4g4sl_
    complexed with cl, mg; mutant

Details for d5cgfk_

PDB Entry: 5cgf (more details), 2.8 Å

PDB Description: yeast 20s proteasome beta5-g48c mutant
PDB Compounds: (K:) Proteasome subunit beta type-5

SCOPe Domain Sequences for d5cgfk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cgfk_ d.153.1.4 (K:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmagcaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

SCOPe Domain Coordinates for d5cgfk_:

Click to download the PDB-style file with coordinates for d5cgfk_.
(The format of our PDB-style files is described here.)

Timeline for d5cgfk_: