Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins) the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2 there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus) |
Protein automated matches [190854] (27 species) not a true protein |
Species Coxsackievirus a16 (strain tainan/5079/98) [TaxId:231417] [277504] (1 PDB entry) |
Domain d5c8cc_: 5c8c C: [277505] Other proteins in same PDB: d5c8ca_ automated match to d5c4wc_ complexed with cl, k, ste |
PDB Entry: 5c8c (more details), 2.5 Å
SCOPe Domain Sequences for d5c8cc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c8cc_ b.121.4.1 (C:) automated matches {Coxsackievirus a16 (strain tainan/5079/98) [TaxId: 231417]} giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyrah aragyfdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedieqtan iq
Timeline for d5c8cc_: