Lineage for d5c8cc_ (5c8c C:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assembliesSuperfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) 
Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)Protein automated matches [190854] (27 species)
not a true protein
Species Coxsackievirus a16 (strain tainan/5079/98) [TaxId:231417] [277504] (1 PDB entry) 
Domain d5c8cc_: 5c8c C: [277505]
Other proteins in same PDB: d5c8ca_
automated match to d5c4wc_
complexed with cl, k, ste
Details for d5c8cc_
PDB Entry: 5c8c (more details), 2.5 Å
PDB Description: crystal structure of recombinant coxsackievirus a16 capsid
PDB Compounds: (C:) vp3SCOPe Domain Sequences for d5c8cc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c8cc_ b.121.4.1 (C:) automated matches {Coxsackievirus a16 (strain tainan/5079/98) [TaxId: 231417]}
giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt
nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm
fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyrah
aragyfdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedieqtan
iq
SCOPe Domain Coordinates for d5c8cc_:
Click to download the PDB-style file with coordinates for d5c8cc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5c8cc_:
- d5c8cc_ first appeared in SCOPe 2.05
- d5c8cc_ appears in SCOPe 2.07
View in 3D
