Lineage for d5b5ej_ (5b5e j:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026440Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) (S)
    automatically mapped to Pfam PF01788
  5. 3026441Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. 3026451Protein automated matches [191002] (3 species)
    not a true protein
  7. 3026459Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (25 PDB entries)
  8. 3026461Domain d5b5ej_: 5b5e j: [329390]
    Other proteins in same PDB: d5b5ea_, d5b5eb_, d5b5ec_, d5b5ed_, d5b5ee_, d5b5ef_, d5b5eh_, d5b5ei_, d5b5ek_, d5b5el_, d5b5em_, d5b5eo_, d5b5et_, d5b5eu_, d5b5ev_, d5b5ex_, d5b5ez_
    automated match to d4ub8j_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b5ej_

PDB Entry: 5b5e (more details), 1.87 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (j:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d5b5ej_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b5ej_ f.23.32.1 (j:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
mmseggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d5b5ej_:

Click to download the PDB-style file with coordinates for d5b5ej_.
(The format of our PDB-style files is described here.)

Timeline for d5b5ej_: