Lineage for d5b21a_ (5b21 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744815Domain d5b21a_: 5b21 A: [327551]
    automated match to d1neua_

Details for d5b21a_

PDB Entry: 5b21 (more details), 2.24 Å

PDB Description: dimer structure of murine nectin-1 d1
PDB Compounds: (A:) murine Nectin-1 D1

SCOPe Domain Sequences for d5b21a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b21a_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvvqvndsmygfigtdvvlhcsfanplpsvkitqvtwqkasngskqnmaiynptmgvsvl
ppyekrveflrpsfidgtirlsgleledegmyicefatfptgnresqlnltvma

SCOPe Domain Coordinates for d5b21a_:

Click to download the PDB-style file with coordinates for d5b21a_.
(The format of our PDB-style files is described here.)

Timeline for d5b21a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5b21b_