Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) Pfam PF13853. Phylogeny described in PubMed 12761335 |
Family f.13.1.0: automated matches [227143] (1 protein) not a true family |
Protein automated matches [226845] (25 species) not a true protein |
Species Thermus thermophilus [TaxId:798128] [316210] (1 PDB entry) |
Domain d5azdc_: 5azd C: [316212] automated match to d3ddla_ |
PDB Entry: 5azd (more details), 2.8 Å
SCOPe Domain Sequences for d5azdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5azdc_ f.13.1.0 (C:) automated matches {Thermus thermophilus [TaxId: 798128]} lpelsfgeywlvfnmlsltiagmlaafvffllarsyvapryhialylsalivfiagyhyl rifeswvgayqlqdgvyvptgkpfndfyryadwlltvpllllelilvlgltaartwnlsi klvvasvlmlalgyvgevntepgprtlwgalssipffyilyvlwvelgqaireakfgprv lellgatrlvllmswgfypiayalgtwlpggaaqevaiqigysladliakpiygllvfai araksleegfg
Timeline for d5azdc_: