Lineage for d5azdc_ (5azd C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022990Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 3022991Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 3023317Family f.13.1.0: automated matches [227143] (1 protein)
    not a true family
  6. 3023318Protein automated matches [226845] (25 species)
    not a true protein
  7. 3023576Species Thermus thermophilus [TaxId:798128] [316210] (1 PDB entry)
  8. 3023579Domain d5azdc_: 5azd C: [316212]
    automated match to d3ddla_

Details for d5azdc_

PDB Entry: 5azd (more details), 2.8 Å

PDB Description: crystal structure of thermophilic rhodopsin.
PDB Compounds: (C:) bacteriorhodopsin

SCOPe Domain Sequences for d5azdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5azdc_ f.13.1.0 (C:) automated matches {Thermus thermophilus [TaxId: 798128]}
lpelsfgeywlvfnmlsltiagmlaafvffllarsyvapryhialylsalivfiagyhyl
rifeswvgayqlqdgvyvptgkpfndfyryadwlltvpllllelilvlgltaartwnlsi
klvvasvlmlalgyvgevntepgprtlwgalssipffyilyvlwvelgqaireakfgprv
lellgatrlvllmswgfypiayalgtwlpggaaqevaiqigysladliakpiygllvfai
araksleegfg

SCOPe Domain Coordinates for d5azdc_:

Click to download the PDB-style file with coordinates for d5azdc_.
(The format of our PDB-style files is described here.)

Timeline for d5azdc_: