Lineage for d5aebb_ (5aeb B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997604Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2997605Protein automated matches [190418] (31 species)
    not a true protein
  7. 2998017Species Uncultured bacterium [TaxId:506514] [276865] (1 PDB entry)
  8. 2998019Domain d5aebb_: 5aeb B: [276867]
    automated match to d4ax0b_
    complexed with co, so4, zn

Details for d5aebb_

PDB Entry: 5aeb (more details), 2.1 Å

PDB Description: crystal structure of the class b3 di-zinc metallo-beta-lactamase lra- 12 from an alaskan soil metagenome.
PDB Compounds: (B:) lra-12

SCOPe Domain Sequences for d5aebb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aebb_ d.157.1.0 (B:) automated matches {Uncultured bacterium [TaxId: 506514]}
qkvkeptvsnadwskpyrpfriagnlyyigtydlacylittkqgniivntglaasalqik
nnikalgfkltdtkillttqahydhlgamaeikkitgaklmadegdatvmadggssdyaf
gghgsmfepiiadrllhdkdtiqlgdtklvmlhhpghtkgscsflfdtkdeqrsyrilia
nmptiviekkfsevssypgiakdyaytlqamknlsfdiwvashasqfsmhskhkpgdgyn
pksfmdrkgydesldklqkeyekhln

SCOPe Domain Coordinates for d5aebb_:

Click to download the PDB-style file with coordinates for d5aebb_.
(The format of our PDB-style files is described here.)

Timeline for d5aebb_: