Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (31 species) not a true protein |
Species Uncultured bacterium [TaxId:506514] [276865] (1 PDB entry) |
Domain d5aebb_: 5aeb B: [276867] automated match to d4ax0b_ complexed with co, so4, zn |
PDB Entry: 5aeb (more details), 2.1 Å
SCOPe Domain Sequences for d5aebb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aebb_ d.157.1.0 (B:) automated matches {Uncultured bacterium [TaxId: 506514]} qkvkeptvsnadwskpyrpfriagnlyyigtydlacylittkqgniivntglaasalqik nnikalgfkltdtkillttqahydhlgamaeikkitgaklmadegdatvmadggssdyaf gghgsmfepiiadrllhdkdtiqlgdtklvmlhhpghtkgscsflfdtkdeqrsyrilia nmptiviekkfsevssypgiakdyaytlqamknlsfdiwvashasqfsmhskhkpgdgyn pksfmdrkgydesldklqkeyekhln
Timeline for d5aebb_: