Lineage for d5acwa_ (5acw A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) 
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) Protein automated matches [190079] (12 species)
not a true proteinSpecies Pseudomonas aeruginosa [TaxId:287] [189349] (76 PDB entries) 
Domain d5acwa_: 5acw A: [278793]
automated match to d4ua4b_
complexed with cl, oh, rhu, zn
Details for d5acwa_
PDB Entry: 5acw (more details), 1.8 Å
PDB Description: vim-2-1, discovery of novel inhibitor scaffolds against the metallo- beta-lactamase vim-2 by spr based fragment screening
PDB Compounds: (A:) Beta-lactamaseSCOPe Domain Sequences for d5acwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5acwa_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
geyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgak
ntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegnei
pthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagn
vadadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs
SCOPe Domain Coordinates for d5acwa_:
Click to download the PDB-style file with coordinates for d5acwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5acwa_:
- d5acwa_ first appeared in SCOPe 2.05
- d5acwa_ appears in SCOPe 2.07
View in 3D
