Lineage for d4yl1a_ (4yl1 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028966Fold f.56: MAPEG domain-like [161083] (1 superfamily)
    4 helices, bundle; left-handed superhelix
  4. 3028967Superfamily f.56.1: MAPEG domain-like [161084] (2 families) (S)
  5. 3029003Family f.56.1.0: automated matches [193735] (1 protein)
    not a true family
  6. 3029004Protein automated matches [193736] (1 species)
    not a true protein
  7. 3029005Species Human (Homo sapiens) [TaxId:9606] [193737] (14 PDB entries)
  8. 3029011Domain d4yl1a_: 4yl1 A: [273837]
    automated match to d4al0a_
    complexed with 4u8, bog, gsh, peg, pg4

Details for d4yl1a_

PDB Entry: 4yl1 (more details), 1.41 Å

PDB Description: crystal structures of mpges-1 inhibitor complexes
PDB Compounds: (A:) Prostaglandin E synthase

SCOPe Domain Sequences for d4yl1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yl1a_ f.56.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slvmsspalpafllcstllvikmyvvaiitgqvrlrkkafanpedalrhggpqycrsdpd
verclrahrndmetiypflflgfvysflgpnpfvawmhflvflvgrvahtvaylgklrap
irsvtytlaqlpcasmalqilweaarhl

SCOPe Domain Coordinates for d4yl1a_:

Click to download the PDB-style file with coordinates for d4yl1a_.
(The format of our PDB-style files is described here.)

Timeline for d4yl1a_: