Lineage for d4y0aa_ (4y0a A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871587Species Acinetobacter baumannii [TaxId:557600] [276067] (1 PDB entry)
  8. 2871588Domain d4y0aa_: 4y0a A: [276068]
    automated match to d1viab_
    complexed with skm, so4

Details for d4y0aa_

PDB Entry: 4y0a (more details), 1.91 Å

PDB Description: shikimate kinase from acinetobacter baumannii in complex with shikimate
PDB Compounds: (A:) Shikimate kinase

SCOPe Domain Sequences for d4y0aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y0aa_ c.37.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 557600]}
pskafetlpniylvgpmgagkttvgrhlaellgrefldsdheierktgatipwifekege
vgfrtretvvlneltsrkalvlatgggaitqapnreflkqrgivvylytpvelqlqrtyr
dknrpllqvenpeqklrdllkirdplyrevahytietnqgaardlaqkilqlilsnklk

SCOPe Domain Coordinates for d4y0aa_:

Click to download the PDB-style file with coordinates for d4y0aa_.
(The format of our PDB-style files is described here.)

Timeline for d4y0aa_: