Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza A virus h6n1 subtype [TaxId:119212] [269451] (9 PDB entries) |
Domain d4xkga_: 4xkg A: [271075] Other proteins in same PDB: d4xkgb_, d4xkgd_, d4xkgf_ automated match to d3gbna_ complexed with gal, nag, sia |
PDB Entry: 4xkg (more details), 2.25 Å
SCOPe Domain Sequences for d4xkga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xkga_ b.19.1.0 (A:) automated matches {Influenza A virus h6n1 subtype [TaxId: 119212]} pgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctie gwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfp kstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfw gvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpg etlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvs plwigecpkyvkseslrlatglrnvpqiat
Timeline for d4xkga_: