Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d4x4ya_: 4x4y A: [301269] Other proteins in same PDB: d4x4yb_, d4x4yd_ automated match to d2q20b_ mutant |
PDB Entry: 4x4y (more details), 2.49 Å
SCOPe Domain Sequences for d4x4ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x4ya_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesggglvqpggslrlscaasgfniddtyihwvrqapgkglewvariyptngytry adsvkgrftisadtskntaylqmnslraedtavyycsrwggdgfyamdvwgqgtlvtvs
Timeline for d4x4ya_: