Lineage for d4x1ch_ (4x1c H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2202456Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2202457Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2202458Family d.80.1.1: 4-oxalocrotonate tautomerase-like [55332] (5 proteins)
    dimer of beta-alpha-beta subunits: may assemble further in hexamer (trimer of the dimers)
  6. 2202459Protein 4-oxalocrotonate tautomerase [55333] (2 species)
  7. 2202460Species Pseudomonas putida, XylH [TaxId:303] [55335] (9 PDB entries)
  8. 2202468Domain d4x1ch_: 4x1c H: [270066]
    automated match to d1bjpa_
    complexed with nco

Details for d4x1ch_

PDB Entry: 4x1c (more details), 1.7 Å

PDB Description: crystal structure of 4-ot from pseudomonas putida mt-2 with an enamine adduct on the n-terminal proline at 1.7 angstrom resolution
PDB Compounds: (H:) 2-hydroxymuconate tautomerase

SCOPe Domain Sequences for d4x1ch_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x1ch_ d.80.1.1 (H:) 4-oxalocrotonate tautomerase {Pseudomonas putida, XylH [TaxId: 303]}
piaqihilegrsdeqketlirevseaisrsldapltsvrviitemakghfgiggelaskv
rr

SCOPe Domain Coordinates for d4x1ch_:

Click to download the PDB-style file with coordinates for d4x1ch_.
(The format of our PDB-style files is described here.)

Timeline for d4x1ch_: