Lineage for d4wxvc_ (4wxv C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032807Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 3032808Protein automated matches [190829] (14 species)
    not a true protein
  7. 3032821Species Cow (Bos taurus) [TaxId:9913] [255754] (9 PDB entries)
  8. 3032839Domain d4wxvc_: 4wxv C: [275297]
    Other proteins in same PDB: d4wxva_, d4wxvb_
    automated match to d4bnri_
    complexed with ca, so4; mutant

Details for d4wxvc_

PDB Entry: 4wxv (more details), 2.1 Å

PDB Description: human cationic trypsin k97d mutant in complex with bovine pancreatic trypsin inhibitor (bpti)
PDB Compounds: (C:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d4wxvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wxvc_ g.8.1.0 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtc

SCOPe Domain Coordinates for d4wxvc_:

Click to download the PDB-style file with coordinates for d4wxvc_.
(The format of our PDB-style files is described here.)

Timeline for d4wxvc_: