Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (77 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [232714] (3 PDB entries) |
Domain d4wwha_: 4wwh A: [341922] automated match to d4ywhb_ complexed with gal, trs |
PDB Entry: 4wwh (more details), 1.2 Å
SCOPe Domain Sequences for d4wwha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wwha_ c.93.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} akgtvgiamptksserwvadgqnmvdqfkafgydtdlqygddvvqnqvsqienmitkgvk llviapidgssltntlqhaadlkipvisydrlikgtpnvdyyatfdntkvgvlqanyivd tlgvadgkgpfnlelfagspddnnatyffqgamsvlqpyidsgklvvksgqttfdqiatl rwdgglaqsrmdnllsqaytsgrvdavlspydgisrgvisalksagygnaakplpivtgq daelasvksivageqtqtvfkdtrelakaavqeadavltggtpqvndtetydngvkvvps ylldpvsvdksnykkvlidsgyytetqvq
Timeline for d4wwha_: