Lineage for d4wwha_ (4wwh A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
parallel beta-sheet of 6 strands, order 213456Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) 
Similar in architecture to the superfamily II but partly differs in topology
Family c.93.1.0: automated matches [191439] (1 protein)
not a true familyProtein automated matches [190646] (77 species)
not a true protein
Species Mycobacterium smegmatis [TaxId:246196] [232714] (3 PDB entries) 
Domain d4wwha_: 4wwh A: [341922]
automated match to d4ywhb_
complexed with gal, trs
Details for d4wwha_
PDB Entry: 4wwh (more details), 1.2 Å
PDB Description: crystal structure of an abc transporter solute binding protein (ipr025997) from mycobacterium smegmatis (msmeg_1704, target efi- 510967) with bound d-galactose
PDB Compounds: (A:) ABC transporterSCOPe Domain Sequences for d4wwha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wwha_ c.93.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
akgtvgiamptksserwvadgqnmvdqfkafgydtdlqygddvvqnqvsqienmitkgvk
llviapidgssltntlqhaadlkipvisydrlikgtpnvdyyatfdntkvgvlqanyivd
tlgvadgkgpfnlelfagspddnnatyffqgamsvlqpyidsgklvvksgqttfdqiatl
rwdgglaqsrmdnllsqaytsgrvdavlspydgisrgvisalksagygnaakplpivtgq
daelasvksivageqtqtvfkdtrelakaavqeadavltggtpqvndtetydngvkvvps
ylldpvsvdksnykkvlidsgyytetqvq
SCOPe Domain Coordinates for d4wwha_:
Click to download the PDB-style file with coordinates for d4wwha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4wwha_:
- d4wwha_ first appeared in SCOPe 2.06
- d4wwha_ appears in SCOPe 2.07
View in 3D
