Lineage for d4wsoa_ (4wso A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469071Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2469072Protein automated matches [190459] (59 species)
    not a true protein
  7. 2469143Species Burkholderia thailandensis [TaxId:271848] [189811] (3 PDB entries)
  8. 2469146Domain d4wsoa_: 4wso A: [261007]
    automated match to d1yuma_
    complexed with nad, po4

Details for d4wsoa_

PDB Entry: 4wso (more details), 2.05 Å

PDB Description: x-ray crystal structure of a nicotinate nucleotide adenylyltransferase from burkholderia thailandensis bound to nad
PDB Compounds: (A:) Probable nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d4wsoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsoa_ c.26.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
lpalprrigilggtfdpihdghlalarrfadvlrltelvlmpagqpyqkqdvsaaehrla
mtraaagslvlpgvavsvatdeiehagptytvetlerwrerlgadaslslligadqlvrl
dtwrdwrrlfdfahvcaatrpgfdfaaaspavaaeiasrqasadvlratpagrllidttl
aldvaatdirahlraciarhaqvpdasaehvspavwayilqhrlyhp

SCOPe Domain Coordinates for d4wsoa_:

Click to download the PDB-style file with coordinates for d4wsoa_.
(The format of our PDB-style files is described here.)

Timeline for d4wsoa_: