Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins) |
Protein automated matches [190260] (25 species) not a true protein |
Species Coxsackievirus b3 [TaxId:103903] [188493] (5 PDB entries) |
Domain d4wfza_: 4wfz A: [260608] automated match to d4k4za_ complexed with na |
PDB Entry: 4wfz (more details), 1.8 Å
SCOPe Domain Sequences for d4wfza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wfza_ e.8.1.4 (A:) automated matches {Coxsackievirus b3 [TaxId: 103903]} geiefiesskdagfpvintpsktklepsvfhqvfegnkepavlrsgdprlkanfeeaifs kyignvnthvdeymleavdhyagqlatldistepmkledavygteglealdlttsagypy valgikkrdilskktkdltklkecmdkyglnlpmvtyvkdelrsiekvakgksrlieass lndsvamrqtfgnlyktfhlnpgvvtgsavgcdpdlfwskipvmldghliafdysgydas lspvwfaclkmileklgythketnyidylcnshhlyrdkhyfvrggmpsgcsgtsifnsm inniiirtlmlkvykgidldqfrmiaygddviasypwpidasllaeagkgyglimtpadk gecfnevtwtnvtflkryfradeqypflvhpvmpmkdihesirwtkdpkntqdhvrslcl lawhngeheyeefirkirsvpvgrcltlpafstlrrkwldsf
Timeline for d4wfza_: