Lineage for d4weud_ (4weu D:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (24 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) 
Domain d4weud_: 4weu D: [271541]
automated match to d3stbb_
Details for d4weud_
PDB Entry: 4weu (more details), 2.61 Å
PDB Description: co-complex structure of the f4 fimbrial adhesin faeg variant ad with llama single domain antibody v3
PDB Compounds: (D:) Anti-F4+ETEC bacteria VHH variable regionSCOPe Domain Sequences for d4weud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4weud_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlscaasgltfdtyamgwfrqapgkkreyvaaiswtgistyy
adiakgrftisrdnakntlylqmdslkpedtavyycaaqkslnvpapwdywgqgtqvtvs
s
SCOPe Domain Coordinates for d4weud_:
Click to download the PDB-style file with coordinates for d4weud_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4weud_:
- d4weud_ first appeared in SCOPe 2.05
- d4weud_ appears in SCOPe 2.07
View in 3D
