Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (20 species) not a true protein |
Species Brucella abortus [TaxId:359391] [259594] (1 PDB entry) |
Domain d4w9uc1: 4w9u C:4-241 [259595] Other proteins in same PDB: d4w9ua2, d4w9ub2, d4w9uc2, d4w9ud2 automated match to d3ii9a1 complexed with edo |
PDB Entry: 4w9u (more details), 2.4 Å
SCOPe Domain Sequences for d4w9uc1:
Sequence, based on SEQRES records: (download)
>d4w9uc1 e.6.1.0 (C:4-241) automated matches {Brucella abortus [TaxId: 359391]} aafawedpflleeqltedermirdsakafasdvllprvekayleettdpelfhlmgqagl lgvtlpedygaanasyvayglvareveridsgyrsmmsvqsslvmypiyaygsdeqrkky lpglvsgeligcfgltepdagsdpagmktraekidggyrlsgskmwisnspiadvfvvwa ksaahdnairgfilekgmkglsapkiggklslrasitgeivmdgvevsedailpnvsg
>d4w9uc1 e.6.1.0 (C:4-241) automated matches {Brucella abortus [TaxId: 359391]} aafawedpflleeqltedermirdsakafasdvllprvektdpelfhlmgqagllgvtlp edygaanasyvayglvareveridsgyrsmmsvqsslvmypiyaygsdeqrkkylpglvs geligcfgltepmktraekidggyrlsgskmwisnspiadvfvvwaksaahdnairgfil ekgmkglsapkilrasitgeivmdgvevsedailpnvsg
Timeline for d4w9uc1: