Lineage for d4w81a_ (4w81 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024425Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)
  8. 2024554Domain d4w81a_: 4w81 A: [267568]
    automated match to d4jvpa_
    complexed with so4

Details for d4w81a_

PDB Entry: 4w81 (more details), 2.25 Å

PDB Description: periplasmically produced monomeric single domain antibody (sdab) c22a/c99v variant against staphylococcal enterotoxin b (seb) at ph 8.0
PDB Compounds: (A:) Single Domain Antibody

SCOPe Domain Sequences for d4w81a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w81a_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
maevqlvesggglvqagdslrlsatasgrtfsravmgwfrqapgkerefvaaisaapgta
yyafyadsvrgrfsisadsakntvylqmnslkpedtavyyvaadlkmqvaaymnqrsvdy
wgqgtqvtvss

SCOPe Domain Coordinates for d4w81a_:

Click to download the PDB-style file with coordinates for d4w81a_.
(The format of our PDB-style files is described here.)

Timeline for d4w81a_: