Lineage for d4vhba_ (4vhb A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.2: Globins [46463] (27 proteins)
Heme-binding protein
Protein Bacterial dimeric hemoglobin [46526] (1 species) Species Vitreoscilla stercoraria [TaxId:61] [46527] (7 PDB entries) 
Domain d4vhba_: 4vhb A: [15631]
complexed with hem, scn
Details for d4vhba_
PDB Entry: 4vhb (more details), 1.8 Å
PDB Description: thiocyanate adduct of the bacterial hemoglobin from vitreoscilla sp.
PDB Compounds: (A:) protein (hemoglobin)SCOPe Domain Sequences for d4vhba_:
Sequence, based on SEQRES records: (download)
>d4vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
mldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamt
vlaaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddild
awgkaygviadvfiqveadlyaqave
Sequence, based on observed residues (ATOM records): (download)
>d4vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
mldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfeqpkalamtvlaaaqni
enlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygv
iadvfiqveadlyaqave
SCOPe Domain Coordinates for d4vhba_:
Click to download the PDB-style file with coordinates for d4vhba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4vhba_:
- d4vhba_ first appeared (with stable ids) in SCOP 1.55
- d4vhba_ appears in SCOPe 2.07
View in 3D
