Lineage for d4v2ia_ (4v2i A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.0: automated matches [191404] (1 protein)
not a true familyProtein automated matches [190543] (91 species)
not a true protein
Species Thalassospira sp. [TaxId:1485225] [280473] (1 PDB entry) 
Domain d4v2ia_: 4v2i A: [280476]
automated match to d1evqa_
complexed with mg
Details for d4v2ia_
PDB Entry: 4v2i (more details), 1.69 Å
PDB Description: biochemical characterization and structural analysis of a new cold- active and salt tolerant esterase from the marine bacterium thalassospira sp
PDB Compounds: (A:) Esterase/lipaseSCOPe Domain Sequences for d4v2ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4v2ia_ c.69.1.0 (A:) automated matches {Thalassospira sp. [TaxId: 1485225]}
pvlepttqkfinalsasggpaiytltpaeardvlsgaqsgeiakpavditdttfavgptg
atkvriirpqgntdrlpvivyfhgagwvmgdtgthdrlvrelsvranaalvfvdyerspe
arypvaieqdyavtkyvaehseqlnvdptrlaiagdsvggnmtavvsllaqerggpdita
qvlfypvtdadfdngsytefangpwltkpamdwfwnqylpegidrtdpkitpihatseql
sgqapalvitaendvlrdegeayarklsqagvdvtvtryngtihdfvmlnvladtpaakg
aiaqagqylhtalhg
SCOPe Domain Coordinates for d4v2ia_:
Click to download the PDB-style file with coordinates for d4v2ia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4v2ia_:
- d4v2ia_ first appeared in SCOPe 2.05
- d4v2ia_ appears in SCOPe 2.07
- d4v2ia_ appears in the current release, SCOPe 2.08
View in 3D
