Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (99 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [196470] (52 PDB entries) |
Domain d4uhia_: 4uhi A: [318322] automated match to d4cohb_ complexed with hem, vfv |
PDB Entry: 4uhi (more details), 2.04 Å
SCOPe Domain Sequences for d4uhia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uhia_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaallfns knedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiieketk eyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfshaawl lpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrpltdde vagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydqlkdl nlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswverld fnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidgyfp tvnyttmihtpenpvirykrrs
Timeline for d4uhia_: